SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019826 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019826
Domain Number 1 Region: 377-436
Classification Level Classification E-value
Superfamily Leucine zipper domain 3.63e-17
Family Leucine zipper domain 0.0001
Further Details:      
 
Domain Number 2 Region: 12-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000492
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019826   Gene: ENSPPYG00000017688   Transcript: ENSPPYT00000020609
Sequence length 508
Comment pep:known_by_projection chromosome:PPYG2:7:55561280:55976079:-1 gene:ENSPPYG00000017688 transcript:ENSPPYT00000020609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSA
RLPNHDTSVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSSVSEVVGSSTLSQLTTHRTDLNPIL
Download sequence
Identical sequences A0A096MS69 A0A1D5Q1F1 A0A2I2YIZ4 A0A2K5I6P2 A0A2K5N4W9 A0A2K5TR38 A0A2K5ZPQ0 A0A2K6CAB8 A0A2K6PM35 H2PMI8
ENSPPYP00000019826 ENSPPYP00000019826 9600.ENSPPYP00000019826 XP_007979963.1.81039 XP_010386626.1.97406 XP_011729567.1.29376 XP_011793999.1.43180 XP_011827629.1.47321 XP_011937851.1.92194 XP_011937860.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]