SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019829 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019829
Domain Number 1 Region: 13-41
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000298
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019829
Domain Number - Region: 171-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000139
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number - Region: 208-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.011
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019829   Gene: ENSPPYG00000017691   Transcript: ENSPPYT00000020612
Sequence length 243
Comment pep:known chromosome:PPYG2:7:56221034:56582576:1 gene:ENSPPYG00000017691 transcript:ENSPPYT00000020612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSY
INRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSS
SFRSSTPTGDEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGC
KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRK
MQQ
Download sequence
Identical sequences H2PMJ1
ENSPPYP00000019829 ENSPPYP00000019829 9600.ENSPPYP00000019829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]