SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019892 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019892
Domain Number 1 Region: 388-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 421-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000179
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019892   Gene: ENSPPYG00000017747   Transcript: ENSPPYT00000020678
Sequence length 507
Comment pep:known_by_projection chromosome:PPYG2:7:63696006:63699910:1 gene:ENSPPYG00000017747 transcript:ENSPPYT00000020678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSLLGEEPRLGSTPLAMLAATCNKIGSPSPSPSSLSDSSSSFGKGFHPWKRSSSSSSA
SCNVVGSSLSSFGVSGTSRNGGSSSAAAAAAAAAAAAAALVSDSFSCGGSPGSSAFSLTS
SSAAAAAAAAAAAASSSPFANDYSVFQAPGVSGGSGGGGGGGGGGSSAHSQDGSHQPVFI
SKVHTSVDGLQGIYPRVGMAHPYESWFKPSHPGLGAAGEVGSAGTSSWWDVGAGWIDVQN
PNSAAALPGSLHPAAGGLQTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLMDG
FKPVLPGSYPDSAPSPLAGAGGSMLSAGPSAPLGGSPRSSARRYSGRATCDCPNCQEAER
LGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDE
LQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHVKTHSGGGGGGSAGSGSGGKKGSDTDSE
HSAAGSPPCHSPELLQPPEPGHRNGLE
Download sequence
Identical sequences H2PMQ1
ENSPPYP00000019892 XP_002818213.1.23681 ENSPPYP00000019892 9600.ENSPPYP00000019892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]