SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019894 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019894
Domain Number 1 Region: 143-386
Classification Level Classification E-value
Superfamily vWA-like 4e-77
Family Integrin A (or I) domain 0.000000549
Further Details:      
 
Domain Number 2 Region: 387-473
Classification Level Classification E-value
Superfamily Integrin domains 2.67e-20
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 44-102
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000183
Family Plexin repeat 0.00084
Further Details:      
 
Domain Number 4 Region: 591-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family Integrin beta EGF-like domains 0.0056
Further Details:      
 
Domain Number 5 Region: 547-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019894
Domain Number - Region: 510-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019894   Gene: ENSPPYG00000017749   Transcript: ENSPPYT00000020680
Sequence length 769
Comment pep:known_by_projection chromosome:PPYG2:7:64088100:64167113:-1 gene:ENSPPYG00000017749 transcript:ENSPPYT00000020680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLSQGEDNRCASSNAASCARCLA
LGPECGWCVQEDFISDGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYLNITAICPDGSRKPGMEGCR
NVTSNDEVLFNVTVTMKKCDLTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Download sequence
Identical sequences H2PMQ3
ENSPPYP00000019894 ENSPPYP00000019894 XP_002818218.1.23681 9600.ENSPPYP00000019894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]