SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019899 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019899
Domain Number 1 Region: 102-161
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019899   Gene: ENSPPYG00000017753   Transcript: ENSPPYT00000020685
Sequence length 166
Comment pep:known_by_projection chromosome:PPYG2:7:65449222:65449722:1 gene:ENSPPYG00000017753 transcript:ENSPPYT00000020685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAYPESCVDATVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEG
DPEEEECEVDKGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEA
FDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG
Download sequence
Identical sequences H2PMQ8
9600.ENSPPYP00000019899 XP_002818223.1.23681 ENSPPYP00000019899 ENSPPYP00000019899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]