SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019906 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019906
Domain Number 1 Region: 293-388
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000192
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 122-183
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000511
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 37-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000995
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019906   Gene: ENSPPYG00000017758   Transcript: ENSPPYT00000020692
Sequence length 850
Comment pep:known_by_projection chromosome:PPYG2:7:67326932:67373516:-1 gene:ENSPPYG00000017758 transcript:ENSPPYT00000020692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPAERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQPVVCYNPDQLPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GRLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGKIVLGYTEAELCTRGSGYQFLHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIATQRPLTDEEGTEHLRKRNMKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLNKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIKHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLQLEQQQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQ
FVPFSCPRQDPQQYNVFSDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELD
YPMGSFEPSPFPTTSSLEDFVTCLQVPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEP
QHTHVGQMQYNPVLPGQQAFLNKFQNGVINETYPAELNNINNTQTTTHLQPLHHPSEARP
FPDLTSSEFL
Download sequence
Identical sequences H2PMR5
ENSPPYP00000019906 XP_002818226.1.23681 ENSPPYP00000019906 9600.ENSPPYP00000019906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]