SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019928 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019928
Domain Number 1 Region: 132-179
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000183
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1221-1278
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000785
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 568-632
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000034
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 969-1028
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 298-351
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000405
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 709-762
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 7 Region: 635-704
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number 8 Region: 1348-1412
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 9 Region: 1276-1326
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000119
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 10 Region: 1027-1097
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000129
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 11 Region: 1103-1153
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 12 Region: 359-433
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000746
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019928
Domain Number - Region: 840-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000131
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number - Region: 1156-1212
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000432
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 446-511
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00249
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 
Domain Number - Region: 904-968
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.027
Family TSP-1 type 1 repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019928   Gene: ENSPPYG00000017778   Transcript: ENSPPYT00000020714
Sequence length 1595
Comment pep:known_by_projection chromosome:PPYG2:7:73255240:73547771:1 gene:ENSPPYG00000017778 transcript:ENSPPYT00000020714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGPWGRCMGDECGPGGIQTRAVWCAHVEGWTTLHTNCKQAERPNNQQNCFKVCDWHKELY
DWRLGPWNQCQPVISKSLEKPLECIKGEEGIQVREIACIQKDKDIPAEDIICEYFEPKPL
LEQACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQVCQ
SSPCEADELMYSLHVGPWSTCSMPHSRQVRQARRRGKNKEREKDRSKGVKDPEARELIKK
KRNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQQEKLPMTFQSCVITKECQ
VSEWSEWSPCSKTCHDMVSPAGTRVRTRTIRQFPIGSEKECPELEEKEPCLPQGDGVAPC
AMYGWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQANENLLSQLSTHKN
KEASKPVDLKLCTGPIPNTTQLCHIPCPTECEVSPWSAWGPCTYENCNDQQGKKGFKLRK
RRITNEPTGGSGIARNCPHLLEAIPCEEPACYDWKAVRLGDCEPDNGKECGPGTQVQEVV
CINSDGDEVDRQLCRDAIFPIPVACDAPCPKDCVLSTWSTWSSCSHTCSGKTTEGKQIRA
RSILAYAGEEGGIRCPNSSALQEVRSCNEHPCTVYHWQTGPWGQCIEDTSVSSFNTTTTW
NGEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCKKDCIVTPYSDWTS
CPSSCKEGDSSIRKQSRHRVIIQLPANGGRDCTDPLYEEKACEAPQACQSYRWKTHKWRR
CQLVPWNVQQDSPGAQEGCGPGRQARAITCRKQDGGQAGIHECLQYAGPVPALTQSCQIP
CQDDCQLTGWSKFSSCNGDCGAVRTRKRTLVGKSKKKEKCKNSHLYPLIETQYCPCDKYN
AQPVGNWSDCILPEGKVEVLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNSHG
YIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVNQF
QVYEVVPCHSDCNQYLWVTEPWSICKVTFVNMRENCGEGVQTRKVRCMHNTADGPSEHVE
DYLCDPEEMPLGSRVCKLPCPEDCVISEWGPWTRCVLPCNQSSFRQRSADPIRQPADEGR
SCPNAVEKEPCNLNKNCYHYDYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVDLK
YCEELGLEKNWQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQGDG
RPCPSLMDQSKPCPVKPCYRWQYGQWSPCQVQEAQCGEGTRTRNISCVVSDGSADDFSKV
VDEEFCADIELIIDGNKNVVLEETCTQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGGIQ
VRSKAVIIQELENQHLCPEQMLETKSCYDGQCYEYKWMASAWKGSSRTVWCQRSDGINVT
GGCLVMSQPDADRSCNPPCSQPHSYCSETKTCHCEEGYTEVMSSNSTLEQCTLIPVVVIP
TMEDKRGDVKTSRAVHPTQPSSNPAGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLIFI
VSMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences H2PMT5
9600.ENSPPYP00000019928 ENSPPYP00000019928 ENSPPYP00000019928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]