SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019941 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019941
Domain Number 1 Region: 754-982
Classification Level Classification E-value
Superfamily vWA-like 3.56e-49
Family Integrin A (or I) domain 0.00046
Further Details:      
 
Domain Number 2 Region: 45-227
Classification Level Classification E-value
Superfamily vWA-like 2.67e-31
Family Integrin A (or I) domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1068-1123
Classification Level Classification E-value
Superfamily BPTI-like 5.53e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019941   Gene: ENSPPYG00000017789   Transcript: ENSPPYT00000020727
Sequence length 1125
Comment pep:known_by_projection chromosome:PPYG2:7:77582261:77747646:1 gene:ENSPPYG00000017789 transcript:ENSPPYT00000020727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNRYFVFYLLLLSAFTSQTVSGQRKKGPKSNLLARKSDVQGSICFIDIVFIVDSSESSK
IVLFDKQKDFVDSLSDKIFQLTPGRSLEYDIKLAALQFSSSVQIDPPFSSWKDLQTFKQK
VKSMNLIGQGTFSYYAISNATRLLKREGRKDGVKVALLMTDGIDHPRNPDVQSISEDARI
SGISFITIGLSTVVNEAKLRLISGDSSSEPTLLLSDPTLVDKIQDRLDNLFEKKCERKIC
ECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGNTQKGEAGERGPGGIPGYKGDKGERGEC
GKPGIKGDKGSPGPYGPKGPRGIQGISGPPGDPGPKGFQGNKGEPGPPGPYGSPGAPGIG
QQGIKGERGQEGRLGAPGPIGVGEPGQPGPRGPEGVPGERGLPGEGFPGPKGEKGSEGPT
GPQGLQGLSIKGDKGDMGPVGPQGPMGIPGIGSQGEQGIQGPLGPPGPQGPPGQGLPGSK
GEIGQMGPTGPRGPVGIGVQGPKGEPGSIGLPGQPGVPGEDGAAGKKGEAGLLGARGPEG
PPGKGQPGPKGDEGKKGSKGNQGQRGIPGPEGPKGEPGIMGPFGMPGTSIPGPPGPKGDR
GGPGIPGFKGEPGLSIRGPKGVQGPRGPVGAPGLKGDGYPGVPGPRGLPGPPGPMGLRGV
GDTGAKGEPGVRGPPGPSGPRGIGTQGPKGDTGQKGLPGPPGPPGYGSQGIKGEQGPQGF
PGPKGTMGHGLPGQKGEHGERGDVGKKGDKGEIGEPGSPGKQGLQGPKGDLGLTKEEIIK
LITEICGCGPKCKETPLELVFVIDSSESVGPENFQIIKNFVKTMADRVALDLATARIGVI
NYSHKVEKVANLKQFSSKDDFKLAVDNMQYLGEGTYTATALQAANDMFEDARPGVKKVAL
VITDGQTDSRDKEKLTEVVKNASDTNVEIFVIGVVKKNDPNFEIFHKEMNLIATDPEHVY
QFDDFFTLQDTLKQKLFQKICEDFDSYLVQIFGSSSPQPGFGMSGEELSESTPEPQKEIS
ESLSITGDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVGGAEDPRCLEALKPGN
CGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQETCIQG
Download sequence
Identical sequences H2PMU8
XP_002818254.1.23681 ENSPPYP00000019941 9600.ENSPPYP00000019941 ENSPPYP00000019941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]