SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020007 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020007
Domain Number 1 Region: 41-537
Classification Level Classification E-value
Superfamily Sema domain 3.27e-184
Family Sema domain 0.0000000000152
Further Details:      
 
Domain Number 2 Region: 533-585
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 601-683
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000796
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020007   Gene: ENSPPYG00000017852   Transcript: ENSPPYT00000020796
Sequence length 777
Comment pep:known_by_projection chromosome:PPYG2:7:91130325:91256052:1 gene:ENSPPYG00000017852 transcript:ENSPPYT00000020796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNANKDERLKARSQDFHLFPALMMLSMTMLFLPVTGTLKQNIPRLKLTYKDLLLSNSCIP
FLGSSEGLDFQTLLLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLA
GKDANTECANFIRVLQPYNKTHIYVCGTGAFHPICGYIDLGVYKEDIIFKLDTHNLESGR
LKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNG
AKFIGTFSIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVGGQRSLINKW
TTFLKARLICSIPGSDGADTYFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVY
SMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHSVMYKSVYPVAGGPTFKRINVDYRLTQIVVDHVVAEDGQYDVMFLGTDIGTVLKVV
SISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKA
CADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETADEKV
IFGIEFNSTFLECIPKSQQASIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
GMYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGQVKDLLAESRLRYKDYIQIL
SSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDELPRAVAT
Download sequence
Identical sequences H2PN08
ENSPPYP00000020007 XP_009241344.1.23681 9600.ENSPPYP00000020007 ENSPPYP00000020007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]