SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020010 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020010
Domain Number 1 Region: 1-251
Classification Level Classification E-value
Superfamily Sema domain 9.55e-95
Family Sema domain 0.0000000201
Further Details:      
 
Domain Number 2 Region: 247-301
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000126
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 320-401
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000082
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020010   Gene: ENSPPYG00000017856   Transcript: ENSPPYT00000020800
Sequence length 504
Comment pep:known_by_projection chromosome:PPYG2:7:92926919:92969329:1 gene:ENSPPYG00000017856 transcript:ENSPPYT00000020800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NDVGGQRILVNKWSTFLKARLICSVPGMNGIDTYFDELEDVFLLPTRDHKNPVIFGLFNT
TSNIFRGHAICVYHMSSIRAAFNGPYAHKEGPEYHWSVYEGKVPYPRPGSCASKVNGGRY
GTTKDYPDDAIRFARSHPLMYQAIKPAHKKPILVKTDGKYNLKQIAVDRVEAEDGQYDVL
FIGTDNGIVLKVITIYNQEMESMEEVILEELQIFKDPVPIISMEISSKRQQLYIGSASAV
AQVRFHHCDMYGSACADCCLARDPYCAWDGISCSRYYPTGTHAKRRFRRQDVRHGNAAQQ
CFGQQFVGDALDKTEEHLAYGIENNSTLLECTPRSLQAKVIWFVQKGRETRKEEVKTDDR
VVKMDLGLLFLKLHKSDAGTYFCQTVEHSFVHTVRKITLEVVEEEKVEDMFNKDDEEDRH
HRMPCPAQSSISQGAKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDRKRKKLKMSPSKWKY
ANPQEKKLRSKPEHYRLPRHTLDS
Download sequence
Identical sequences H2PN11
ENSPPYP00000020010 ENSPPYP00000020010 9600.ENSPPYP00000020010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]