SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020016 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020016
Domain Number 1 Region: 28-520
Classification Level Classification E-value
Superfamily Sema domain 1.7e-170
Family Sema domain 0.0000000000905
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000262
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 583-664
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000304
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020016   Gene: ENSPPYG00000017861   Transcript: ENSPPYT00000020806
Sequence length 754
Comment pep:known chromosome:PPYG2:7:95496824:95680586:1 gene:ENSPPYG00000017861 transcript:ENSPPYT00000020806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMD
EDQDRIYVGSKDHILSLNINNISQEPLSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQ
TFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
YFFFKEKLTDNNRSTKQIHSMIXXXXYIPKNDTGGLRSLVNKWTTFLKARLVCSVTDEDG
PETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKE
GPNHQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPVHKR
PLIVRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNSSVSGELILEEL
EVFKNHAPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGH
SCSRFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSP
QASIKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKI
NFKVLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQ
QGDESQKMRGDYGKLKALINSRKSRNRRNQLPES
Download sequence
Identical sequences H2PN17
ENSPPYP00000020016 ENSPPYP00000020016 9600.ENSPPYP00000020016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]