SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020046 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020046
Domain Number 1 Region: 503-536,613-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020046   Gene: ENSPPYG00000017884   Transcript: ENSPPYT00000020836
Sequence length 722
Comment pep:known_by_projection chromosome:PPYG2:7:100052374:100130849:-1 gene:ENSPPYG00000017884 transcript:ENSPPYT00000020836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPV
IMYCFLGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNP
AVIMGARRKAMRKYAKEVGNANMANATVLKATQDAEVDGEDATKPEEEDGEVKYPPIVIK
STFPEEMQRFMPPGDNVHTVVLDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQ
VVNDLTRNRFFENPALWELLFHSIHDAVLGSQLREALAEQEASAPPSQEDLEPNATPATP
EA
Download sequence
Identical sequences H2PN46
ENSPPYP00000020046 9600.ENSPPYP00000020046 ENSPPYP00000020046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]