SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020066 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000020066
Domain Number - Region: 178-229
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.034
Family Intermediate filament protein, coiled coil region 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020066   Gene: ENSPPYG00000017902   Transcript: ENSPPYT00000020858
Sequence length 241
Comment pep:known chromosome:PPYG2:7:103748355:103792016:1 gene:ENSPPYG00000017902 transcript:ENSPPYT00000020858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI
VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL
VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL
VEDQQKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR
L
Download sequence
Identical sequences A0A2J8TAC4 Q5R9U7
NP_001125860.1.23681 ENSPPYP00000020066 ENSPPYP00000020066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]