SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020068 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020068
Domain Number 1 Region: 536-568,649-723
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020068   Gene: ENSPPYG00000017903   Transcript: ENSPPYT00000020860
Sequence length 778
Comment pep:known_by_projection chromosome:PPYG2:7:103837588:103893747:1 gene:ENSPPYG00000017903 transcript:ENSPPYT00000020860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRGRSEPPQLPEYSCSYVVSRPVYSELAFQQQHERRLQERKTLRESLAKGCSCSRKR
AFGVLKTLVPILEWLPKYRVKEWLLSDIISGVSTGLVATLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPNEHFLISSSNGTVLNTTMIDTAA
RDTARVLIASALTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFVLVSQLKIVLM
FQQNYNGVLSISMTLVEIFQNIGDTNLADFTAGLLTIVVCMAVKELNDRFRHKIPVPIPI
EVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPELPPVSLFSEMLAASFSIAVVAYA
IAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKTQV
AGIISAAIVMIAILALGKLLEPLQKSVLAAVVIANLKGMFMQVCDIPRLWRQNKIDAVXX
XXXXXXSIILGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEP
RGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKNGQLRATKN
GIISDAGSTNNAFEPDEDIEDPEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVLDC
GAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTV
HDAILYLQNQVKSQEGQDSILETITLIQDCKDTLELIETELTEEELDVQDEAMRTLAS
Download sequence
Identical sequences H2PN67
ENSPPYP00000020068 ENSPPYP00000020068 9600.ENSPPYP00000020068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]