SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020071 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020071
Domain Number 1 Region: 525-558,640-714
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020071   Gene: ENSPPYG00000017905   Transcript: ENSPPYT00000020863
Sequence length 762
Comment pep:known_by_projection chromosome:PPYG2:7:103944490:103982033:-1 gene:ENSPPYG00000017905 transcript:ENSPPYT00000020863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPFGNQYIVARPVYSTNAFDESHKKRDRHHKTFLDHLKVCCSCSAQKAKRIVLSLFPI
ASWLPAYRLKEWLLSDIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAIIYLFFG
TSRHISVGPFPILSMMVGLAVSGAVSGTVPDGNATTSGLSNDSSNSSSLDDRKVMVAASV
TVLSGIIQLAFGILRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFIFQLTVPSHTDPLS
IFKVLESVFSQIEKTNIADLVTALIVLLVVSIVKEINQRFKDKLPVPIPIEFIMTVIAAG
VSYGFDFKTKFRVAVVGDMNPGFQPPMTPDVQTFQNTIGDCFGIAMVAFAVAFSVASVYS
LKYDYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGKTQIAGLIGAIIVL
IVVLAIGFLLAPLQKSVLAALALGNLKGMLMQFAEIGRLWRKDKYDCLIWIMTFIFAIVL
GLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRSNIYKNKKDYYDMYEPEGVKIFRCPS
PIYFANIGFFRQKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFLCTVDTIK
DSDEELDNNQIEVLDQPINTTDLPFQIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVS
SMRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKNSIFFLTIHDAVLHILM
KKDYSTSKFNPSQEKDGKFDFTINTNGGLRNRVYQVPVETKF
Download sequence
Identical sequences H2PN70
ENSPPYP00000020071 XP_002818387.1.23681 ENSPPYP00000020071 9600.ENSPPYP00000020071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]