SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020095 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020095
Domain Number 1 Region: 501-585
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.9e-29
Family Forkhead DNA-binding domain 0.00000903
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020095
Domain Number - Region: 345-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0321
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020095   Gene: ENSPPYG00000017926   Transcript: ENSPPYT00000020887
Sequence length 713
Comment pep:known_by_projection chromosome:PPYG2:7:110912730:111193620:1 gene:ENSPPYG00000017926 transcript:ENSPPYT00000020887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQESVTETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQA
ARQLLLQQQTSGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
LLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQHPGKQAKEQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQRQGLI
SIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSS
TTSKASPPITHHSIVNGQSSVLNARRDSSSHEETGASHTLYGHGVCKWPGCESICEDFGQ
FLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSPKP
LNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDK
YNIPHFSEIAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFR
RNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPTSL
GYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGC
SPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
Download sequence
Identical sequences H2PN93
ENSPPYP00000020095 ENSPPYP00000020095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]