SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020100 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020100
Domain Number 1 Region: 133-202
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020100   Gene: ENSPPYG00000017928   Transcript: ENSPPYT00000020892
Sequence length 347
Comment pep:known_by_projection chromosome:PPYG2:7:112528699:112576284:-1 gene:ENSPPYG00000017928 transcript:ENSPPYT00000020892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDGGLTENPLTKLLAIGKEDDNAQWH
MEDVIEDIIGMESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL
PMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGT
ILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLGT
VDLGAHVTKQQSHPEQNSVDYCQQLTVSQGPSPELCDQAIAFSDPLSYFTDLSFSAALKE
EQRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL
Download sequence
Identical sequences H2PN98
ENSPPYP00000020100 9600.ENSPPYP00000020100 ENSPPYP00000020100 XP_002818414.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]