SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020106 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020106
Domain Number 1 Region: 59-534
Classification Level Classification E-value
Superfamily Sema domain 1.96e-157
Family Sema domain 0.0000000000000125
Further Details:      
 
Domain Number 2 Region: 1098-1360
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-79
Family Protein kinases, catalytic subunit 0.000000000134
Further Details:      
 
Domain Number 3 Region: 673-747
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000677
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 4 Region: 580-676
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000113
Family Other IPT/TIG domains 0.075
Further Details:      
 
Domain Number 5 Region: 536-582
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000133
Family Plexin repeat 0.0000445
Further Details:      
 
Domain Number 6 Region: 758-844
Classification Level Classification E-value
Superfamily E set domains 0.000000000063
Family Other IPT/TIG domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020106   Gene: ENSPPYG00000017932   Transcript: ENSPPYT00000020898
Sequence length 1409
Comment pep:known chromosome:PPYG2:7:113199470:113322977:1 gene:ENSPPYG00000017932 transcript:ENSPPYT00000020898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSKSKSLAECLAQDKPLIMKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKY
QLPNFTAETLIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDC
SSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCI
FSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKE
TKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRF
CSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDI
LFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRT
LLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGR
FMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCR
HFQSCSQCLSAPPFVQCGWCHDKCVRSEECSSGTWTQQICLPAIYKVFPSSAPLEGGTRL
TICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNILKCTVGPAMNKHFNMSIIIS
NGHGTTQYSTFSYVDPVITGISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKS
VSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTIT
GVGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFF
MLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKS
CENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSI
SIALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESV
DYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPE
LVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEV
SQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDL
IGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKT
GAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRR
LLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKC
VAPYPSLLSSEDNADDEVDTRPASFWETS
Download sequence
Identical sequences A0A0A0MXS4
ENSPPYP00000020106 ENSPPYP00000020106 XP_009241440.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]