SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020153 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020153
Domain Number 1 Region: 484-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000588
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 2 Region: 67-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000017
Family C2HC finger 0.064
Further Details:      
 
Domain Number 3 Region: 222-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000078
Family Plant C2H2 finger (QALGGH zinc finger) 0.076
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020153
Domain Number - Region: 616-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000168
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 288-310,354-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000512
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020153   Gene: ENSPPYG00000017967   Transcript: ENSPPYT00000020946
Sequence length 664
Comment pep:known_by_projection chromosome:PPYG2:7:124417123:124440098:-1 gene:ENSPPYG00000017967 transcript:ENSPPYT00000020946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLRDKYCQTDHHHHGCCEPVYILEPGDPPLLQQPLQTSKSGIQQIIECFRSGTKQLKHI
LLKDVDTIFECKLCRSLFRGLPNLITHKKFYCPPSLQMDDNLPDVNDKQSQAINDLLEAI
YPSVDKREYIIKLEPIETNQNAVFQYISRTDNPVEVTESSSTPEQTEVQIQETSTEQSKT
VPVTDTEVETVEPPPVEIVTDEVAPTSDEQPQESQADLETSDNSDFGHQLICCLCRKEFN
SRRGVRRHIRKVHKKKMEELKKYIETRKNPNQSSKGRSKNVLVPLSRSCPVCCKSFATKA
NVRRHFDEVHRGLRRDSITPDIATKPGQPLFLDSISPKKSFKTRKQKSSSKAEYNLTACK
CLLCKRKYSSQIMLKRHMQIVHKITLSGTNSKREKGPNNTANSSEIKVKVEPADSVESSP
PSITHSPQNELKGTNHSNEKKNTPAAQKNKVKQDSESPKSTSPSAAGGQQKTRKPKLSAG
FDFKQLYCKLCKRQFTSKQNLTKHIELHTDGNNIYVKFYKCPLCTYETRRKRDVIRHITV
VHKKSSRYLGKITASLEIRAIKKPIDFVLNKVAKRGPSRDEAKHSDSKHDGTSNSPSKKY
EVADVGIEVKVTKNFSLHRCNKCGKAFAKKTYLEHHKKTHKANASNSPEGNKTKGRSTRS
KALV
Download sequence
Identical sequences H2PNE1
XP_002818451.1.23681 ENSPPYP00000020153 ENSPPYP00000020153 9600.ENSPPYP00000020153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]