SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020283 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020283
Domain Number 1 Region: 3-45
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000147
Family Eukaryotic proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020283   Gene: ENSPPYG00000018077   Transcript: ENSPPYT00000021079
Sequence length 50
Comment pep:novel chromosome:PPYG2:7:139611939:139613366:-1 gene:ENSPPYG00000018077 transcript:ENSPPYT00000021079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYLQSFPEPCVGSLIHPDWVLTAAHCPLPVEIRLGVSQPSITNKKQQIR
Download sequence
Identical sequences H2PNR7
9598.ENSPTRP00000033892 9600.ENSPPYP00000020283 ENSPPYP00000020283 ENSPPYP00000020283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]