SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020365 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020365
Domain Number 1 Region: 225-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.63e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 169-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-18
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 468-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-16
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 426-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000571
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 351-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000367
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020365   Gene: ENSPPYG00000018158   Transcript: ENSPPYT00000021167
Sequence length 592
Comment pep:known_by_projection chromosome:PPYG2:7:147586370:147594846:-1 gene:ENSPPYG00000018158 transcript:ENSPPYT00000021167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRETLEALSSLGFSVGQPEMAPQSEPREGSHNAQEQMSSSREERALGVCSGHEAPTPEEG
AHTEQAEAPCRGQACTAQKAQPVGACPGEEWMIRKVKVEDEDQEAEEEVEWPQHPSLLPS
PFPPPDLGHLAAAYKLEPGAPGALSGLALSGWGPTPEKPYGCGECERRFRDQLTLRLHQR
LHRGEGPCACPDCGRSFTQRAHMLLHQRSHRGERPFPCSQCDKRFSKKAHLTRHLRTHTG
ERPYPCAECGKRFSQKIHLGSHQKTHTGERPFPCTECEKRFRKKTHLIRHQRIHTGERPY
QCAQCARSFTHKQHLVRHQRVHQAAGPARPSPDSSASPHSTAPSPTPSPPGPKPFACSDC
GLSFGWKKNLATHQCLHRSDGRPFGCDECALGATVDAPAPEPLASAPGGPGCGPGSDPVA
PQRAPSGERSFFCPDCGRGFAHGQHLARHRRVHTGERPFACTQCDRRFGSRPNLVAHSRA
HSGARPFACAQCGRRFSRKSHLGRHQAVHTGSRPHACAVCARSFSSKTNLVRHQAIHTGS
RPFYCPQCGKSFSRKTHLVRHQLHGEAHAAPDALAAPAWSTPPEAAPPPLFF
Download sequence
Identical sequences H2PNZ8
9600.ENSPPYP00000020365 ENSPPYP00000020365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]