SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020371 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020371
Domain Number 1 Region: 31-167
Classification Level Classification E-value
Superfamily L domain-like 1.97e-24
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020371   Gene: ENSPPYG00000018165   Transcript: ENSPPYT00000021174
Sequence length 259
Comment pep:known_by_projection chromosome:PPYG2:7:147946014:147946793:1 gene:ENSPPYG00000018165 transcript:ENSPPYT00000021174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPREEPGEAGGLQITPQLLKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDL
SGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLAIPGQLQCLAG
LPCLEYLRLRDPLARLSNPLCASPSYWAAVRELLPGLKVIDGERVIGRGSEFYQLCRDLD
SSLHPSSSPGPRATEAQPWVEPGYWESWPSQSNSILEEACRQFQDTLQECWDLDRQASDS
LAQAEQALSSAGPTSSFVF
Download sequence
Identical sequences H2PP04
ENSPPYP00000020371 ENSPPYP00000020371 9600.ENSPPYP00000020371 XP_002818696.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]