SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020581 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020581
Domain Number 1 Region: 124-321
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-41
Family DnaQ-like 3'-5' exonuclease 0.00000000292
Further Details:      
 
Domain Number 2 Region: 76-112
Classification Level Classification E-value
Superfamily SAP domain 0.0000961
Family SAP domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020581   Gene: ENSPPYG00000018370   Transcript: ENSPPYT00000021410
Sequence length 349
Comment pep:known_by_projection chromosome:PPYG2:8:10942883:10972580:-1 gene:ENSPPYG00000018370 transcript:ENSPPYT00000021410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDPQSKEPAGEAVAPALLESPQPEGGEEPPRPSPEETQQCRFDGQETKGSKFITSSASD
FSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKES
NCADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINT
QLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSILTDGSWDMSKFLN
IQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSK
NIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK
Download sequence
Identical sequences H2PPL0
XP_009241819.1.23681 ENSPPYP00000020581 9600.ENSPPYP00000020581 ENSPPYP00000020581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]