SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020592 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020592
Domain Number 1 Region: 310-415
Classification Level Classification E-value
Superfamily SRCR-like 7.98e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020592
Domain Number - Region: 139-233
Classification Level Classification E-value
Superfamily STAT 0.00589
Family STAT 0.018
Further Details:      
 
Domain Number - Region: 65-139
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020592   Gene: ENSPPYG00000018381   Transcript: ENSPPYT00000021421
Sequence length 416
Comment pep:known_by_projection chromosome:PPYG2:8:15422838:15492104:-1 gene:ENSPPYG00000018381 transcript:ENSPPYT00000021421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKNSPSLQEKLKSFRAALIALSLLVFAVLIPLIGIVAAQLLKWETKNCSVGSTNANDITQ
SLAGKGNDSEEEMRFQEVFMEHMSNMEKRIQHISDMEANLIDTEHFQNFSMTTDQRFNDI
LLQLSTLFSSVQGHGNAIDEISKSLMSLNTTLLGLQLNLENLNGKIQENTFKQEEEISKL
EDRVYNVSAEIMAMKEEQVHLEQEIKGEVKILNNITNDLRLKDWEHSQTLRNITLIQGPP
GPPGEKGDQGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQK
GEKGSGNTLTPFKKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPG
VQAVHKAAHFGQGTGPIWLNEVFCFGRESSIEECKIRQWGTRACSHSEDAGVTCTL
Download sequence
Identical sequences H2PPM1
ENSPPYP00000020592 ENSPPYP00000020592 9600.ENSPPYP00000020592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]