SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020702 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020702
Domain Number 1 Region: 392-493
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020702
Domain Number - Region: 89-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020702   Gene: ENSPPYG00000018471   Transcript: ENSPPYT00000021531
Sequence length 495
Comment pep:known_by_projection chromosome:PPYG2:8:27706036:27837004:-1 gene:ENSPPYG00000018471 transcript:ENSPPYT00000021531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKAMYLHTVSNCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASICCTQLGSLSALKH
AVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQAD
LTEQVWKVQDALQNQSDSLLALAGAVQRLEGALWGLQAQAVQTEQAVALLRDRTGQQSDT
AQLELYQLQVESNSSQLLLRRHAGLLDRLARRVGILGEELADVGGVLRGLNHSLSYDVAL
HRTRLQDLRVLVSNASEDTRRLRLAHVGMELQLKQELAMLNAVTEDLRLKDWEHSIALRN
ISLAKGPPGPKGDQGDEGKEGRPGIPGLPGLRGLPGERGTPGLPGPKGDDGKLGATGPMG
MRGFKGDRGPKGEKGEKGDRAGDASGAEAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDD
GWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGTEETIFRCSFSKWGVT
NCGHAEDASVTCNRH
Download sequence
Identical sequences H2PPX4
XP_002818988.1.23681 9600.ENSPPYP00000020702 ENSPPYP00000020702 ENSPPYP00000020702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]