SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020707 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000020707
Domain Number - Region: 280-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0432
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020707   Gene: ENSPPYG00000018476   Transcript: ENSPPYT00000021536
Sequence length 511
Comment pep:known_by_projection chromosome:PPYG2:8:28207407:28227318:-1 gene:ENSPPYG00000018476 transcript:ENSPPYT00000021536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQTKE
VLKAPSTLGLQQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVE
EVWLAELQGPCPQAPPLEPGAQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCS
PVVQSPPGTEANFSASRAACDPWKESGDISDSGSSTTSGHWSGSSGVSTPSPPHPQASPK
YLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPNCGKVLRSIVGIKRH
VKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAGTPVPGTPTAEPAPTPSMTGL
PLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPVSP
HIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAVKSHLIVTSPPRAQSGARKARGE
AKKCRKVYGIEHRDQWCTACRWKKACQRFLD
Download sequence
Identical sequences H2PPX9
ENSPPYP00000020707 ENSPPYP00000020707 XP_009241934.1.23681 9600.ENSPPYP00000020707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]