SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020730 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020730
Domain Number 1 Region: 589-877
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.57e-51
Family Tandem AAA-ATPase domain 0.00027
Further Details:      
 
Domain Number 2 Region: 72-227
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.12e-38
Family DnaQ-like 3'-5' exonuclease 0.012
Further Details:      
 
Domain Number 3 Region: 952-1090
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.18e-30
Family RecQ helicase DNA-binding domain-like 0.000000256
Further Details:      
 
Domain Number 4 Region: 1149-1233
Classification Level Classification E-value
Superfamily HRDC-like 5.45e-20
Family HRDC domain from helicases 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020730   Gene: ENSPPYG00000018494   Transcript: ENSPPYT00000021559
Sequence length 1432
Comment pep:known_by_projection chromosome:PPYG2:8:31042019:31189712:1 gene:ENSPPYG00000018494 transcript:ENSPPYT00000021559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKKLETTPQQRKCPEWMNAQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDAS
DCSFLSEDISMSLSDGDVVGFDMEWPPLYKKRKLGKVALIQLCVSESKCYLFHISSMSVF
PQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELADVANKKLKCTETWSLNSL
VKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRFAIN
KEEEILLSNMNKQLTSISEEVMDLAKHLPDAFSKLENPRRVSILLKDISENLYSLRKMII
GSTNIETELRPSNNLNLLSFEDSTTGRVQQKQIREHEVLINVEDETWDPTLDHLAKHDGE
DVLGNKVERKEDGFEDGVEDNKLKENTERACLMSLDITEHELQILEQQAQEEYLSDIAYK
STEHLSPNNNENDTSYVIESDEDLEMEMLKHLSPNNNENDTSYVIESDEDLEMEMLKSLE
NLNSGTVEPTHSKCLKMERNLGLPTKEEEDDDENEANEEEKDDDKDSLLPAPNEEQVTCL
KMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLIS
LMEDQVLQLKMSNVPACFLGSAQSENVLTDIKLGKYRIVYITPEYCSGNMGLLQQLEADI
GITLIAVDEAHCISEWGHDFRNSFRKLGSLKTALPMVPIVALTATASSSIQEDIVRCLNL
RNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTEQV
TAELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYG
APKEMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKME
KYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDNYYSMDDSEDTSWDFG
PQAFKLLSAVDILEEKFGIGLPILFLRGSNSRRLADQYRRHSLFGTGKDQTESWWKAFSR
QLITEGFLVEVPGYNKFVKICTLTRKGRNWLHKANTESRSLILQANEELCPKKFLLPSSK
TVSSGTKEHYYNQVPVELTTEKKSNLEKLYSYKPCDKISSGSNISKKSIMVQSPEKSYSS
SEPAISSQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENIKR
IDGVSEGKAAMLAPLLEVIKHFCQTNNVQTDLFSSTKPQEEQKTSLVAKKKICTLSQSMA
ITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVI
RNPPVNSDMSKINLIRMLVPENIDTYLIHMAIEILKHGPDSRLQPSCDVNKRRCFPSSEE
ICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Download sequence
Identical sequences H2PQ01
ENSPPYP00000020730 ENSPPYP00000020730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]