SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020745 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020745
Domain Number 1 Region: 837-915
Classification Level Classification E-value
Superfamily DEATH domain 3.7e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 143-234
Classification Level Classification E-value
Superfamily Immunoglobulin 5.96e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 233-283
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000562
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 289-336
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 36-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000169
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020745   Gene: ENSPPYG00000018506   Transcript: ENSPPYT00000021577
Sequence length 940
Comment pep:known_by_projection chromosome:PPYG2:8:35734970:35991791:1 gene:ENSPPYG00000018506 transcript:ENSPPYT00000021577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYQCRLCSDVFFDFTGTDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKAR
PAMQIFFKCNGEWVHQNEHVSEESLDKSSGLKVREVFINVTRQQVEDFHGPEDYWCQCVA
WSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEE
PIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSW
TEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTSLCPVDGSWEVWSEWS
VCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQRWSRRG
IENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSALTGGFQTFNFKTVR
QGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFMVSL
GVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKTPYIQNLSSLPTRTELRTTGVFGHLGG
RLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLSPEVTCGPPDMIVT
TPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACHVLLDSF
GTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQ
LLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWCSNRQPLHCAFSLE
RYTPTTTQLSCKICIRQLKGHEQILQVQTSILENERETITFFTQEDSTFPAQTGPKAFKI
PYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQHDG
DLDSLACALEEIGRTHMKLSNISESQLDEADFNYSRQNGL
Download sequence
Identical sequences H2PQ15
ENSPPYP00000020745 ENSPPYP00000020745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]