SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020788 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020788
Domain Number 1 Region: 122-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000218
Family HkH motif-containing C2H2 finger 0.017
Further Details:      
 
Domain Number 2 Region: 63-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000128
Family HkH motif-containing C2H2 finger 0.0057
Further Details:      
 
Domain Number 3 Region: 6-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000278
Family HkH motif-containing C2H2 finger 0.0025
Further Details:      
 
Domain Number 4 Region: 186-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000533
Family C2HC finger 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020788   Gene: ENSPPYG00000018540   Transcript: ENSPPYT00000021621
Sequence length 229
Comment pep:known_by_projection chromosome:PPYG2:8:41014674:41386336:-1 gene:ENSPPYG00000018540 transcript:ENSPPYT00000021621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRL
RSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPL
SPLKPPRMDTAPVVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLE
QLGTTLDMGELRGLRRNYRCTTCSVSLNSIEQYHAHLKGSKHQTNLKNK
Download sequence
Identical sequences H2PQ57
XP_002819078.1.23681 ENSPPYP00000020788 ENSPPYP00000020788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]