SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020818 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020818
Domain Number 1 Region: 10-164
Classification Level Classification E-value
Superfamily Hook domain 1.27e-57
Family Hook domain 0.000001
Further Details:      
 
Domain Number 2 Region: 717-787
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 1.96e-23
Family Protein prenylyltransferase 0.0000162
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020818
Domain Number - Region: 519-605
Classification Level Classification E-value
Superfamily t-snare proteins 0.0282
Family t-snare proteins 0.013
Further Details:      
 
Domain Number - Region: 248-329
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0353
Family Myosin rod fragments 0.0034
Further Details:      
 
Domain Number - Region: 310-412
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020818   Gene: ENSPPYG00000018562   Transcript: ENSPPYT00000021651
Sequence length 804
Comment pep:known_by_projection chromosome:PPYG2:8:43424595:43605645:1 gene:ENSPPYG00000018562 transcript:ENSPPYT00000021651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDPAYFDENWLNR
IKTEVGDNWRLKISNLKKILKGILDYNHEILGQQINDFTLPDVNLIGEHSDAAELGRMLQ
LILGCAVNCEQKQEYIQAIMMMEESVQHVVMTAIQELMSKESPVSAGNDAYVDLDRQLKK
TTEELNEALSAKEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPA
GRRHLQLQTQLEQLQEETFRLEAAKDDYRIRCEELEKEISELRQQNDELTTLADEAQSLK
DEIDVLRHSSDKVSKLEGQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQNTVSLEEELRK
ANAARSQLETYKRQVVELQNRLSEESKKADKLDFEYKRLKEKVDSLQKEKDRLRTERDSL
KETIEELRCVQAQEGQLTTQGLMPLGSQESSDSLAAEIVTPEIREKLIRLQHENKMLKLN
QEGSDNEKIALLQSLLDDANLRKNELETENRLVNQRLLEVQSQVEELQKSLQDQGSKAED
SVLLKKKLEEHLEKLHEANNELQKKRAIIEDLEPRFNNSSLKIEELQEALRKKEEEMKQM
EERYKKYLEKAKSVIRTLDPKQNQGAAPEIQALKNQLQERDRLFHSLEKEYEKTKSQREM
EEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSSRRSYPGHVQPATARDR
AEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAA
NYTVWNLNFGTMSCSMWTNFSKRM
Download sequence
Identical sequences H2PQ84
ENSPPYP00000020818 ENSPPYP00000020818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]