SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020893 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020893
Domain Number 1 Region: 240-316
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.19e-16
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020893   Gene: ENSPPYG00000018628   Transcript: ENSPPYT00000021727
Sequence length 380
Comment pep:known_by_projection chromosome:PPYG2:8:66799067:66800209:1 gene:ENSPPYG00000018628 transcript:ENSPPYT00000021727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGMHLGAAAAGEDDLFLHKSLSASTAKRLEAAFRSTPPGMDLSLAPPPRERPASSSSS
PLGCFEPADPEGAGLLLPPPGGGGGGGGGAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSS
LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGA
KAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGAGGGGGGSGGSSSSSSKKSKEQK
ALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALE
EMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLPPAASCPE
KCALFNSVSSSLCKQCTEKP
Download sequence
Identical sequences H2PQF3
ENSPPYP00000020893 ENSPPYP00000020893 XP_002819174.1.23681 9600.ENSPPYP00000020893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]