SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020938 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020938
Domain Number 1 Region: 105-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020938   Gene: ENSPPYG00000018665   Transcript: ENSPPYT00000021775
Sequence length 206
Comment pep:known_by_projection chromosome:PPYG2:8:74232413:74236317:-1 gene:ENSPPYG00000018665 transcript:ENSPPYT00000021775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCA
LGAAGSAGGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARM
RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW
PFVVSGRPDSDTKEVSAANRLCGTTA
Download sequence
Identical sequences A0A096NE13 A0A2K5HS64 A0A2K5VHH3 A0A2K6B470 A0A2K6KAL0 A0A2K6QU69 G7MZI9 H2PQJ5
ENSPPYP00000020938 9600.ENSPPYP00000020938 ENSPPYP00000020938 XP_001082936.1.72884 XP_005563580.1.63531 XP_010357102.1.97406 XP_011742818.1.29376 XP_011812817.1.43180 XP_017728216.1.44346 ENSPANP00000011121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]