SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020972 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020972
Domain Number 1 Region: 343-462
Classification Level Classification E-value
Superfamily POZ domain 5.3e-27
Family BTB/POZ domain 0.00059
Further Details:      
 
Domain Number 2 Region: 712-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000116
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020972   Gene: ENSPPYG00000018696   Transcript: ENSPPYT00000021812
Sequence length 849
Comment pep:known_by_projection chromosome:PPYG2:8:83348869:83382296:1 gene:ENSPPYG00000018696 transcript:ENSPPYT00000021812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFSEMNRRTLAFRGGGLVTASGGGSTNNNAGGEASAWPPQPQPRQPPPPAPPALQPPNG
RGADEEVELEGLEPQDLEASAGAAAGAAEEAKELLLPQDAGGPTSLGGGGAGGPLLAERN
RRTLAFRGGGGGGLGNNGSSRGRPETSAWPLRHFNGRGPATVDLELDALEGKELMQDGAS
LSDSTEDEEEGASLGDGSGAEGGSCSSSRRSGGDGGDEVEGSGVGAGEGETVQHFPLARP
KSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPADGGSVDLPQVGHDELSRGT
RNYKKTLLLRHHVSTEHKLHEANAQESEIPSEEGYCDFNSRPNENSYCYQLSATTNEQRK
KGILCDVSIVVSGKIFKAHKNILVAGSRFFKTLYCFSNKESPNQNNTTHLDIAAVKGFSV
ILDFLYSGNLVLTSQNAIEVMTVASYLQMSEVVQTCRNFIKDALNISIKSEAPESVVVDY
NNRKPVNRDGLSSSRDQKIASFWATRNLTNLASNVKIENDGCNVDEGQIENYQMNDSSWV
QDGSPEMAENESEGQTKVFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPQPNNETNLED
CSVMQPPVAYPEENTLLIKEEPDLDGALLSGPDGDRNVNANLLAEAGTSQDGGDAGTSND
FKYGLIPGASNDFKYGLLPESWPKQETWENGESSLIMNKLKCPHCSYVAKYRRTLKRHLL
IHTGVRSFSCDICGKLFTRREHVKRHSLVHKKDKKYKCMVCKKIFMLAASVGIRHGSRRY
GVCVDCADKSQPGGQEGVDQGQDTEFPRDEEYEENEVGEADEELVDDGEDQNDPSRWDES
GEVCMSLDD
Download sequence
Identical sequences H2PQM8
9600.ENSPPYP00000020972 ENSPPYP00000020972 ENSPPYP00000020972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]