SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020987 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020987
Domain Number 1 Region: 48-203
Classification Level Classification E-value
Superfamily L domain-like 5.78e-31
Family Internalin LRR domain 0.058
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020987
Domain Number - Region: 820-922
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00228
Family Myosin rod fragments 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020987   Gene: ENSPPYG00000018711   Transcript: ENSPPYT00000021827
Sequence length 1030
Comment pep:known_by_projection chromosome:PPYG2:8:88097974:88138074:1 gene:ENSPPYG00000018711 transcript:ENSPPYT00000021827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAAAAAAAAEVENEDGDSSCGDVCFMDKGLQSISELSLDSTLHAVNLHCNNISKIEAI
DHIWNLRHLDLSSNQISRIEGLNTLTKLCTLNLSCNLITKVEGLEELINLTRLNVSYNHI
DDLSGDDSLHGIKHKLRYIDLHSNCIDSIHHLQCMVGLHFLTNLILEKNGDDNPVCQLPG
YRAVILQTLPQLRILDCKNIFGEPVNLAEINSSQLQCLEGLLDNLVSSDSPLNISEDEII
DRMPVITAPIDELVPLEQFASTPSDAVLTSFMSVCQSSEPEKSNHESDLQNEIKLQKLDD
QILQLLNETSNSIDNVPEEDPRPKRDTDITSESDYGNRKECNRKVHRRSKIPYYAKTIQT
IKHHNKNYSSFVSCNRKMKPPYLKELYVSSSLANYPMLQESEKPKTEIIKVDQSHSEDNT
YQSLVEQLDQEREKRWRAEQAENKLMDYIDELHKHANEKEDIHSLALLTTDRLKEIIFRE
RNSKGQLEVMVHKLQNEIKKLTVELMKAKDQQEDHLKHLRTLEKTLEKMERQKRQQQAAQ
IRLIQEVELKASAADREIYLLRTSLHREREQVQQLHELLALKEQEHRKELETREFFTDAE
FQDALAKEIAKEEKKHEQVIKEYQEKIDVLSKQYMDLENEFRIALTVEARRFQDVKDGFE
NVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLAEVSKLKQETAANLQNQIN
TLEILIEDDKQKSIQIELLKHEKVQLISELAAKESLIFGLRTERKVWGHELAQQGSSLAQ
NRGKLEAQIESLSRENECLRKTNESDSDALRIKCKIIDDQTETIRKLKDSLQEKEEHIKR
LQEKITEIKKCTQERLDEKSSQLDEVLEKLERHNERKENLKQQLKGKEVELEEIRKAYST
LNRKWHDKGELLCHLETQVKEVKEKFENKEKKLKAERDKSIELQKNAMEKLHSMDDAFKK
QVDAIVEAHQAEIAQLANEKQKCIDSANLKVHQIEKEMRELLEETCKNKKTMEAKIKQLA
FALNEIQQDM
Download sequence
Identical sequences H2PQP3
ENSPPYP00000020987 9600.ENSPPYP00000020987 ENSPPYP00000020987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]