SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020997 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020997
Domain Number 1 Region: 116-269
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-26
Family DnaQ-like 3'-5' exonuclease 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020997   Gene: ENSPPYG00000018720   Transcript: ENSPPYT00000021837
Sequence length 289
Comment pep:novel chromosome:PPYG2:8:88847262:88848233:-1 gene:ENSPPYG00000018720 transcript:ENSPPYT00000021837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSRAALYSRLQEFLLTQDQLKENGYPFPHPERPGGAVLFTGLGKGPGDSSCRVCCRC
GTDYLVSSSGRCLRDQLCYYHWGRVRSSQVAGGRVSQYTCFVTFKKEFSRDAYPGIYALD
CEMCYTMHGLELTRVTVVDADMRVVDTFVKPDNEIVDYNTRFSGVTEADVAKTSITLPKV
QAILLSFFSAQTILIGHSLESDLLALKLIHSTVVDTAVLFPQHLGFPYKRSLRNLAADYL
GQIIQDSQDGHNSSEDANACLQLVMWKVRQRAQIQPCHRSCSPAALACP
Download sequence
Identical sequences H2PQQ3
9600.ENSPPYP00000020997 ENSPPYP00000020997 ENSPPYP00000020997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]