SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021010 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021010
Domain Number 1 Region: 16-37,124-201,243-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000393
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021010
Domain Number - Region: 12-52,248-317,371-482
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0156
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021010   Gene: ENSPPYG00000018731   Transcript: ENSPPYT00000021850
Sequence length 506
Comment pep:known_by_projection chromosome:PPYG2:8:93136317:93150871:1 gene:ENSPPYG00000018731 transcript:ENSPPYT00000021850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEA
RHLSIVDQDLEYLSEGLEGRSSNPVAVLFDTLLSPDADFGMIYPSVLHWKLEQHHYIPHL
VLGKGPPGGAWHNMEGSMLTISFGSWMELPGLKFKDWVSSKRRNLKGDRVMPEEIARYYK
HYVKVMGLQKNFRENTYITSVSRRYRDQDDDDSQDRDISTKHLQIEKSNFIKRNWEIRGY
QRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRDK
VDPVLIVGSGLTAADAVLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMM
CTQSYSVDSNLLSDYTSFPEHHVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLS
FLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALG
VTRCLATRQKKKQHLFVERGGGDGIA
Download sequence
Identical sequences H2PQR6
ENSPPYP00000021010 9600.ENSPPYP00000021010 ENSPPYP00000021010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]