SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021021 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021021
Domain Number 1 Region: 495-527,566-632
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000667
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021021   Gene: ENSPPYG00000018740   Transcript: ENSPPYT00000021861
Sequence length 656
Comment pep:known_by_projection chromosome:PPYG2:8:97484849:97638034:1 gene:ENSPPYG00000018740 transcript:ENSPPYT00000021861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERIVP
QNMQNLTTQSNTSVLGLSDFEMQRIRVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQELLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFILIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVHKIDWGIWVSTYLFTICFAANVGLLFGVVCTIAVVIGRFPRTMTVSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNIIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEETSQSCPNEKCSLILDCSGFTFFDYSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV
Download sequence
Identical sequences H2PQS7
ENSPPYP00000021021 ENSPPYP00000021021 XP_002819305.1.23681 XP_009242212.1.23681 9600.ENSPPYP00000021021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]