SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021034 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021034
Domain Number 1 Region: 268-435
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.46e-17
Family Canonical RBD 0.00079
Further Details:      
 
Domain Number 2 Region: 481-574
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9e-17
Family Canonical RBD 0.0015
Further Details:      
 
Domain Number 3 Region: 73-216
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000111
Family DnaQ-like 3'-5' exonuclease 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021034
Domain Number - Region: 671-711
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0125
Family Canonical RBD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021034   Gene: ENSPPYG00000018753   Transcript: ENSPPYT00000021876
Sequence length 726
Comment pep:known_by_projection chromosome:PPYG2:8:100938951:101005580:1 gene:ENSPPYG00000018753 transcript:ENSPPYT00000021876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSEEGGWALFLFLLEEGLAQVFSFSLPHHLTASRPPPFSPSPPIVMTASPDYLVVLFGIT
AGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESL
SSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYS
FFDLRKEFKKCCPGSPDIDKLDTAAMTEYLNFEKNSSVSRYGASQVEDMGSIILAMISEP
YNHRFSDPERVNYKFESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGA
ALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHMGTRYIEVYKATGEDFLKIAGGTSNE
VAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHCPITGGKEGILFVTYPDGRPTGDAFV
LFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSAPLIPLPTPPIIPVLPQ
QFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQM
KSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSPPPCKLPCLSPP
SYTFPAPAAVIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMNYTAYYPSPPGSPNSL
GYFPTAANLSGVPPQPGTVVRMQGLAYNTGVKEILNFFQGYQYATEDGLIHTNDQARTLP
KEWVCI
Download sequence
Identical sequences H2PQT8
9600.ENSPPYP00000021034 ENSPPYP00000021034 ENSPPYP00000021034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]