SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021056 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021056
Domain Number 1 Region: 610-835
Classification Level Classification E-value
Superfamily vWA-like 1.43e-62
Family Integrin A (or I) domain 0.0003
Further Details:      
 
Domain Number 2 Region: 46-238
Classification Level Classification E-value
Superfamily vWA-like 8.76e-57
Family Integrin A (or I) domain 0.00024
Further Details:      
 
Domain Number 3 Region: 323-441
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.49e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 240-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-18
Family Growth factor receptor domain 0.0071
Further Details:      
 
Domain Number 5 Region: 403-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000111
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 525-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000222
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 569-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000398
Family EGF-type module 0.019
Further Details:      
 
Domain Number 8 Region: 911-954
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000209
Family Chicken cartilage matrix protein 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021056   Gene: ENSPPYG00000018773   Transcript: ENSPPYT00000021899
Sequence length 957
Comment pep:known_by_projection chromosome:PPYG2:8:104242737:104412454:1 gene:ENSPPYG00000018773 transcript:ENSPPYT00000021899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKMLAGCFLLILGQILLLPAEARERSRGRSISRGRHARTHPQTALLESSCENKRADLVF
IIDSSRSVNTHDYAKVKEFIVDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEV
ERAVKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEV
AAKARDTGILIFAIGVGQVDFNTLKAIGSEPHEDHVFLVANFSQIETLTSVFQKKLCTAH
MCSTLEHNCAHFCINIPGSYVCRCKQGYILNSDQTTCRIQDLCAMEDHNCEQLCVNVPGS
FVCQCYSGYALAEDGKRCMAVDYCASENHGCEHECVNADGSYLCQCHEGFALNPDKKTCT
KIDYCASSHGCQHECVNTDDSYSCRCLKGFTLNPDKKTCRRINYCALNKPGCEHECVNTE
ESYYCRCRRGYTLDLNGKTCSRVDHCAQQDHGCEQLCLNTEESFVCQCSEGFLINEDLKT
CSRVDYCLLSDHGCEYSCVNMDRSFACQCPEGHMLRSDGKTCAKLDSCALGDHGCEHSCV
SSEDSFACQCFEGYILREDGKTCRRKDVCQAIDHGCEHICVNSDNSYTCKCLEGFQLAED
GKRCRRKDVCKSTHHGCEHICVNNGNSYICKCSEGFLLAEDGRRCKKCTEGPIDLVFVID
GSKSLGEENFEVVKQFVTGIIDSLTISPKAARVGLLQYSTQVRTEFTLRNFNSAKDMKKA
VAHMKYMGKGSMTGLALKHMFERSFTQGEGARPLSTRVPRAAIVFTDGRAQDDVSEWASK
AKANGITMYAVGVGKAIEEELQEIASEPTTKHLFYAEDFSTMDEISEKLKKGICEALEDS
DGRQDSPAGELPKRVQQPTESEPVTINIQDLLSCSNFAVQHRYLFEDDNLLRSTQKLSHS
TKPSGSPLEEKHDQCKCENLIMFQNLANEEVRKLTQRYLLEEMTQRMEALENRLRYR
Download sequence
Identical sequences H2PQV9
ENSPPYP00000021056 9600.ENSPPYP00000021056 ENSPPYP00000021056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]