SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021088 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021088
Domain Number 1 Region: 431-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000384
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 464-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000411
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021088   Gene: ENSPPYG00000018800   Transcript: ENSPPYT00000021931
Sequence length 528
Comment pep:known chromosome:PPYG2:8:109231865:109243069:-1 gene:ENSPPYG00000018800 transcript:ENSPPYT00000021931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGQTALSAAAAGAASSVSPGARLWPSSQQPAAEQPVSLPPAAKQPTMLNFGASLQQTA
EERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLS
EEENLLPGTPDFHTVPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAA
PFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQSCPVKAASILNYQDNSFRRRTHLN
IEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSMPSSETVICRSQPAPVSPQQ
KSVLVSPPAVSAGGVQPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQV
PKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICS
HPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACP
MCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ
Download sequence
Identical sequences H2PQY6
ENSPPYP00000021088 XP_009242276.1.23681 ENSPPYP00000021088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]