SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021114 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021114
Domain Number 1 Region: 96-148
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021114
Domain Number - Region: 36-115
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000754
Family Growth factor receptor domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021114   Gene: ENSPPYG00000018818   Transcript: ENSPPYT00000021957
Sequence length 195
Comment pep:known_by_projection chromosome:PPYG2:8:114706171:114912637:-1 gene:ENSPPYG00000018818 transcript:ENSPPYT00000021957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLF
FFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCAKGCEVGHWSEWGTCSRNNRTCGFKWG
LETRTRQIVKKPAKDTIPCPTIAESRRCKMTVRHCPGGKRTPKAKEKRNKKKKRKLTERA
QEQHSVFLATDRANQ
Download sequence
Identical sequences H2PR11
ENSPPYP00000021114 ENSPPYP00000021114 9600.ENSPPYP00000021114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]