SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021139 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021139
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000518
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number 2 Region: 102-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000209
Family Fibronectin type I module 0.044
Further Details:      
 
Domain Number 3 Region: 206-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000314
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021139   Gene: ENSPPYG00000018841   Transcript: ENSPPYT00000021982
Sequence length 357
Comment pep:known_by_projection chromosome:PPYG2:8:127024889:127032930:1 gene:ENSPPYG00000018841 transcript:ENSPPYT00000021982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSVQSTRFCLRKRCLCLTFLLLHLLGQVAATQRCPPQCPGQCPATPPTCAPGVRAVLDG
CSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICMAVEGDNCVFDGVIYRSG
EKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDS
LGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQ
TRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRC
CTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Download sequence
Identical sequences H2PR31
ENSPPYP00000021139 9600.ENSPPYP00000021139 XP_002819431.1.23681 ENSPPYP00000021139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]