SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021145 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021145
Domain Number 1 Region: 143-337
Classification Level Classification E-value
Superfamily vWA-like 2.67e-57
Family Integrin A (or I) domain 0.0000943
Further Details:      
 
Domain Number 2 Region: 1010-1179
Classification Level Classification E-value
Superfamily vWA-like 2.52e-43
Family Integrin A (or I) domain 0.00055
Further Details:      
 
Domain Number 3 Region: 1198-1401
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.87e-35
Family Laminin G-like module 0.038
Further Details:      
 
Domain Number 4 Region: 536-702
Classification Level Classification E-value
Superfamily Fibronectin type III 2.97e-22
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 739-909
Classification Level Classification E-value
Superfamily Fibronectin type III 4.32e-18
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 6 Region: 354-440
Classification Level Classification E-value
Superfamily Fibronectin type III 1.32e-17
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 7 Region: 31-115
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-16
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 447-532
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 9 Region: 922-1005
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000373
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021145   Gene: ENSPPYG00000018846   Transcript: ENSPPYT00000021988
Sequence length 1761
Comment pep:known_by_projection chromosome:PPYG2:8:127744106:128006633:1 gene:ENSPPYG00000018846 transcript:ENSPPYT00000021988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFQRKMRYWLLPPFLAIVYFCTIVQGQVAPPTRLRYNVISHDSIQISWKAPRGKFGGY
KLLVTPASGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
EKRKDPKPRVKVVDRGNGSRPSSPEEVKFVCQTPAIADIVILVDGSWSIGRFNFRLVRLF
LENLVTAFDVGSEKTRIGLAQYSGDPRIEWHLNAFSTKDEVIEAVRNLPYKGGNTLTGLA
LNYIFENSFKPEAGSRTGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADVN
ELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTLCSRVEEQDREIKASAHAITGPPTELI
TSEVTASSFMVNWTHAPGNVEKYRVVYYPTRGGKPDEVVVDGSVSSTVLKNLMSLTEYQI
AVFAIYAHTASEGLRGTETTLALPMASELLLYDVTENSMRVKWDAVPGASGYLILYAPLT
EGLAGDEKEMKIGETHTDIELSGLLPNTEYTVTVYAMFGEEASDPVTGQETTLALSPPRN
LRISNVGSNSARLTWDPTSRQINGYRIVYNNADGTEINEVEVDPITTFPLKGLTPLTEYT
IAIFSIYDEGQSEPLTGVFTTEEVPAQQYLEIDEVTTDSFRVTWHPLSADEGLHKLMWIP
VYGGKTEEVVLKEEQDSHVIEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTLDSFWTEP
ATTIVPTTPVTSVFQTGIRNLVVGDETTSSLRVKWDISDSDVQQFRVTYMTAQGDPEEEV
VGTVMVPGSQNILLLKPLLPDTEYKVTVTPIYTDGEGVSVSAPGKTLPSSGPQNLRVSEE
WYNRLRITWDPPSSPVKGYRIVYKPVSVPGPTLETFVGADINTILITNLLSGMDYNVKIF
ASQASGFSDALTGMVKTLFLGVTNLQAKHVEMTSLCAHWQVHRHATAYRVVIESLQDRQK
QESTVGGGTTRHCFYGLQPDSEYKISVYTKLQEIEGPSVSIMEKTHSLPTQPPTFPPTIP
PAKEVCKAAKADLVFMVDGSWSIGDENFNKIISFLYSTVGALNKIGTDGTQVAMVQFTDD
PRTEFKLNAYKTKETLLDAIKHISYKGGNTKTGKAIKYVRDTLFTAESGYSIFAIGVADA
DYSELVSIGSKPSARHVFFVDDFDAFKKIEDELITFVCETASATCPMVHKDGIDLAGFKM
MEMFGLVEKDFSSVEGVSMEPGTFNVFPCYQLHKDALVSQPTRYLHPEGLPSDYTISFLF
RILPDTPQEPFALWEILNKNSDPLVGVILDNGGKTLTYFNYDQSGDFQTVTFEGPEIRKI
FYGSFHKLHIVVSETLVKVVIDCKQVGEKAMNASANITSDGVEVLGKMVRSRGPGGNSAP
FQLQMFDIVCSTSWADTDKCCELPGLRDDESCPDLPHSCSCSETNEVALGPAGPPGGPGL
RGPKGQQGEPGPKGPDGPRGELGLPGPQGPPGPQGPSGLSIQGMPGMPGEKGEKGDTGLP
GPQGIPGGVGSPGRDGSPGQRGLPGKDGSSGPPGPPGPIGIPGAPGVPGITGSMGPQGAL
GPPGVAKGDRERGDLQSQAMVRSVARQVCEQLIQSHMARYTAILNQIPSHSSSIRTVQGP
PGEPGRPGSPGAPGEQGPPGTPGFPGNAGVPGTPGERGLTGIKGEKGNPGVGTQGPRGPP
GPAGPSGESRPGSPGPPGSPGPRGPPGHLGVPGPQGPSGQPGYCDPSSCSAYGVRAPHPD
QPEFTPVQDELEAMELWGPGV
Download sequence
Identical sequences H2PR37
ENSPPYP00000021145 ENSPPYP00000021145 9600.ENSPPYP00000021145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]