SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021156 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021156
Domain Number 1 Region: 97-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.19e-20
Family Classic zinc finger, C2H2 0.000069
Further Details:      
 
Domain Number 2 Region: 662-728
Classification Level Classification E-value
Superfamily Homeodomain-like 3.34e-16
Family Homeodomain 0.0012
Further Details:      
 
Domain Number 3 Region: 60-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000149
Family Classic zinc finger, C2H2 0.00036
Further Details:      
 
Domain Number 4 Region: 466-533
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000257
Family Homeodomain 0.0039
Further Details:      
 
Domain Number 5 Region: 567-633
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000342
Family Homeodomain 0.0000378
Further Details:      
 
Domain Number 6 Region: 298-350
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000012
Family Homeodomain 0.012
Further Details:      
 
Domain Number 7 Region: 781-825
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000513
Family Homeodomain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021156   Gene: ENSPPYG00000018856   Transcript: ENSPPYT00000021999
Sequence length 873
Comment pep:known_by_projection chromosome:PPYG2:8:130924793:130927414:-1 gene:ENSPPYG00000018856 transcript:ENSPPYT00000021999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTRAESISSDEEVHESVDSDN
QQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEH
NLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFVKEENAEQAESTEVSSSGISISK
TPIMKMMKNKVENKRIAVHHNSVEDVPEEKENEIKPDREETVENPSSSASESNTSTSIVN
RIHPSTASTVVTPAAVLPGLAQVITAVSAQQNSNLIPKVLIPVNSIPTYNAALDNNPLLL
NTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEEARRKQFNGTV
HTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLTQVAGTNTLPVTAPIALTVAGV
PSQNNVQKSQVPAAQPTAETKPATAAVPTSQSVKHETALVNPDSFGIRAKKTKEQLAELK
VSYLKNQFPHDSEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIII
DSSDETTESPTVGTVQPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLNNSVLTDEELNR
LRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGSSKEEAGETSPGDESGAPKSGS
TGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNL
KWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKT
GTAILKDYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGVELFEENEEEDE
VIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD
Download sequence
Identical sequences H2PR46
9600.ENSPPYP00000021156 XP_003777353.1.23681 XP_009242343.1.23681 ENSPPYP00000021156 ENSPPYP00000021156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]