SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021220 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021220
Domain Number 1 Region: 404-460
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000379
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 465-515
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000706
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 3 Region: 518-573
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000379
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 4 Region: 352-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000314
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 261-309
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021220
Domain Number - Region: 590-637
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000288
Family Hormone receptor domain 0.006
Further Details:      
 
Domain Number - Region: 936-1050
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0522
Family Rhodopsin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021220   Gene: ENSPPYG00000018916   Transcript: ENSPPYT00000022066
Sequence length 1512
Comment pep:known_by_projection chromosome:PPYG2:8:150796248:150878047:1 gene:ENSPPYG00000018916 transcript:ENSPPYT00000022066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQAAAPGPVWILAPLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAVF
PANASRCSWTLRNPDPRRYTLYMKVAKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESFD
EVLRLCDPSAPLAFLQASKQFLQMRRQQPPQDDELRPRAGPPGPTDDFSVEYLVVGNRNP
SRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGEAGGPAAGPLAPRGDVCLRDAVA
GGPENCLTSLTQDRGGHGATGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGVEGGGCEG
VLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEWS
PWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSLC
SSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACSA
SCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGAG
SQRRERVCSGPFFGGAACQGPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVAA
VRCPRNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGLPGEG
VSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDVQNFVHILSNLLA
EENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYVTDNLVLSIHKLPASGAT
DISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLAEADEASVFVVGTVLYRNLGSFLALQ
RNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMYNGTTNQTCILWDETDVPSSSAPPQLG
PWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADAVVCTLVAAFLHFFFLSSFCWVLT
EAWQSYMAVTGHLRNRLIRKRFLCLGWGLPALVVAISVGFTKKGYSTMNYCWLSLEGGLL
YAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSCVVLPLLALTWMS
AVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVVDRQEEGNGDSGG
SFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPEEEKLKLAHAKGP
PTNFNSLPANVSKLHLHGSPRYPGGPLPDFPNHSLTLKRDKAPKSSFVGDGDIFKKLDSE
LSRAQEKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHLSTAPEASLPARS
PPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGEPGEPAAHPGPS
TGPSTKNENVATLSVSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHAAEKDKE
VLGPDSKPEKQQTPNKRPWESLRKAHGTPTWVKKELEPLQPSPLELRSVEWERSGATIPL
VGQDIIDLQTEV
Download sequence
Identical sequences H2PRB0
ENSPPYP00000021220 ENSPPYP00000021220 9600.ENSPPYP00000021220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]