SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021289 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021289
Domain Number 1 Region: 6-407
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.42e-22
Family LacY-like proton/sugar symporter 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021289   Gene: ENSPPYG00000018983   Transcript: ENSPPYT00000022137
Sequence length 412
Comment pep:known_by_projection chromosome:PPYG2:8:152871423:152873253:1 gene:ENSPPYG00000018983 transcript:ENSPPYT00000022137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGKLLPLAGLYLVQGLPYGLQSGLLPVLLRAGGLSLTRVGLAKVLYAPWLLKLAWAPVV
DAQGSARAWLTRSTAGLGLVCGLLAGLPPPGAGQAGLPAAVAGLLLLLNLGAAMQDVALD
ALAVQLLEPAELGPGNTVQVVAYKLGAALAGGALLALLPTLSWPQLFLLLAATYWLAAAL
AWAAPALRRLPQQPPCEQRPHTAHLLRDVLAVPGTLWTAGFVLTYKLGEQGANSLFPLLL
LDHGVSAPELGLWNGVGAVVCSIAGSFLGGTLLAKHWELLPLLRSVLQFRLGSLACQTAL
VFHLDTLGASMDPGTILRGSALLSLCLQHFLGGLVTTVTFTGMMRCSQLAPRALQATHYS
LLATLELLGKLLLGTLAGGLADGLGPHPCFLLLLILSALPILYLGLVPSTFL
Download sequence
Identical sequences H2PRH9
ENSPPYP00000021289 9600.ENSPPYP00000021289 ENSPPYP00000021289 XP_002819609.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]