SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021295 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021295
Domain Number 1 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 78-137
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-22
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 6 Region: 654-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 613-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000519
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 549-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000236
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 9 Region: 470-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000383
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 10 Region: 330-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000156
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 11 Region: 247-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000344
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021295   Gene: ENSPPYG00000018989   Transcript: ENSPPYT00000022143
Sequence length 737
Comment pep:known_by_projection chromosome:PPYG2:8:153097003:153133285:-1 gene:ENSPPYG00000018989 transcript:ENSPPYT00000022143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHGDLPPATQEATPAISFCLLAVLPHPRLNGAEPEFSPLKVSWRRLQARAVSCFLLETT
AAHAHRMAATLQFPGYQEMPLTFQDVAVYFSQAEGQQLGPQQRALYRDVMLENYGNVASL
GFPIPKPELISQLEQGKELWVLNLLGAEEPDILKSCQKDSEVGTKKELSILNQKFSEEVK
NPEFVSRRLLTDNAQAAEFREAWGREGKLEEHLGNSAGQSLNKPSIHKRVLTEATVGRER
SLGERTQECSAFDRNLNLNQNVVRLQRNKTGERVFKCDICSKTFKYNSDLSRHQRSHTGE
KPYECGRCGRAFTHSSNLVLHHHIHTGNKPFKCDECGKTFGLNSHLRLHRRIHTGEKPFG
CGECGKAFSRSSTLIQHRIIHTGEKPYKCNECGRGFSQSPQLTQHQRIHTGEKPHECSHC
GKAFSRSSSLIQHERIHTGEKPHKCNQCGKAFSQSSSLFLHHRVHTGEKPYVCNECGRAF
GFNSHLTEHVRIHTGEKPYVCNECGKAFRRSSTLVQHRRVHTGEKPYQCVECGKAFSQSS
QLTLHQRVHTGEKPYECGDCGKAFSRRSTLIQHQKIHSGETRKCGKRGPAFVHGSSLTAD
RQIPTGEKHSGDFNHGANLILRWTIHTGEKSFGCNEYGKAFSPTSQPTEDQIVHAGEKPY
KCQECGNAFSGNSTLIQHQVTHTGRKPRHCSVCGKPFSQSSQLTPPQQTHVGEKPALNDG
SKRYFIHIKKIFPERHF
Download sequence
Identical sequences H2PRI5
ENSPPYP00000021295 ENSPPYP00000021295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]