SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021298 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021298
Domain Number 1 Region: 196-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 388-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 29-89
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.11e-23
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 4 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 294-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-17
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 429-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021298   Gene: ENSPPYG00000018992   Transcript: ENSPPYT00000022146
Sequence length 532
Comment pep:known_by_projection chromosome:PPYG2:8:153184522:153190645:1 gene:ENSPPYG00000018992 transcript:ENSPPYT00000022146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPQNSLSVAPAPPQRYPGMAMALPKPGPQEAVVFEDVAVYFTRIEWSCLAPDQQALYRD
VMLENYGNLASLGFLVAKPALISLLEQGEEPGALILQGAEQSVAKASLCTDSRMEAGIME
SPLQRKLSTQAGLPGTVWGCLPPAPPHPHGGPEDGSDKPTHPRAREHSASPRVLQEDPSR
PVGSSAPRYRCVCGKAFRYNSLLLRHQIIHTGAKPFQCTECGKAFKQSSILLRHQLIHTE
EKPFQCGECGKAFRQSTQLAAHHRVHTRERPYACGECGKAFSRSSRLLQHQKFHTGEKPF
ACTECGKAFCRRFTLNEHGRIHSGERPYRCLRCGQRFIRGSSLLKHHRLHAQEGAQDGGA
GQGALLRAAQRPQAGDPPHECPVCGRPFRHNSLLLLHLRLHTGEKPFECADCGKAFGRKS
NLTLHQKIHTKEKPFACTECGKAFRRSYTLNEHYRLHSGERPYRCRACGRACSRLSTLIQ
HQKVHGRERREDTGQAGAPLGFLMTGTTGRGFTLEAHPSRRGPSAEIQNPTS
Download sequence
Identical sequences H2PRI8
ENSPPYP00000021298 ENSPPYP00000021298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]