SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021316 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021316
Domain Number 1 Region: 147-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 112-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-17
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 3 Region: 203-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000372
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 68-119
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000276
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021316   Gene: ENSPPYG00000019011   Transcript: ENSPPYT00000022169
Sequence length 253
Comment pep:novel chromosome:PPYG2:8_random:4849725:4852076:-1 gene:ENSPPYG00000019011 transcript:ENSPPYT00000022169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQISKSCITLQLEQGKELWQEGREFLPDQNPDRESALKKKHMISMHPIIRKDASTSMTME
NSLILEDPFECNDSGEDCTHSSTITQCLLTHSGKKPYVSKQYGKSLSNQLSPKPHKQIHT
KGKSYQCNLCEKAYTNSFHLRRHKMTHTGERPYACDLCGKAFTQCSHLRRHEKTHTGERP
YKCHQCGKAFIQSFNLRRHERTHLGKKCYECDKSGKAFSQSSGFRGNKIIHTGEKPHACL
LCGKAFSLSSNLR
Download sequence
Identical sequences H2PRK6
ENSPPYP00000021316 ENSPPYP00000021316 XP_002833130.1.23681 9600.ENSPPYP00000021316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]