SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021348 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021348
Domain Number 1 Region: 699-756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-26
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 868-924
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 755-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.9e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.21e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 909-961
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 811-868
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 421-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 11 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000039
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000165
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 218-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000144
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021348
Domain Number - Region: 98-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0725
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021348   Gene: ENSPPYG00000019045   Transcript: ENSPPYT00000022207
Sequence length 980
Comment pep:known_by_projection chromosome:PPYG2:9:22305572:22308511:1 gene:ENSPPYG00000019045 transcript:ENSPPYT00000022207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYFKVDHIKGIWEKQEKPLWQEIFINDADKTLSKEGQKVLEKPFNLEIAPEFSEKISCKC
DSRRMNLPIASELIISERKYSRKKTEYMNVCEKLQLDIKHEKAHAGEKSYEHGENAKAFS
YKKDQHWKFQTLEESFECDGSGQGLHDKTICITPQSFLTGEKSCKDDEFRKNFDKTTLFN
HMRTATRGKCSDLNEYGTSCDKTTAVEYNKVHMAMTNYECNERGINFSRKSPLTQSQRTI
MGWSAFESNNCEENFSQSSAHIVHQKTQAGDKFGEHNERTNALYQKLDFTAHQRIHTQDK
FYLLDEHGKCRKSFYQKAHLIQHQRPHSGEKTYQYEECAKSFCSSSLPIQHPGTYVGFRL
YECSECGKAFCQNSNLSKHLRIHTKEKPCDNNGCGRSYKSPLIGQQKTDAEMELCGGSEY
GKTSHLKGHQRILMGEKPYECIECGKTFSKTSHLRAHQRIHTGEKPYECVECEKTFSYKT
HLSVHQRVHTGEKPYECNDCGKSFTYNSALRAHQRIHTGEKPYECSDCEKTFAHNSALRA
HHRIHTGEKPYECNECGRSFAHISVLKAHQRIHTGEKPYECSECGRSFTYNSALRAHQRI
HTGRKPYECSDCEKTFAHNSALKIHQRIHTGEKPYECNECEKTFAHNSALRAHQNIHTGE
KLYECSECGKTFFQKTRLSTHRRIHTGEKPYECSKCGKTFSQKSYLSGHERIHTGEKPYE
CNICGKTFVYKAALIVHQRIHTGEKPYECNECGKTFSQRTHLCAHQRIHTGEKPYECNEC
GKTFADNSALRAHHRIHTGEKPYECNECGKTFSKTSHLRAHLRTRSGEKPYECSECGKTF
SEKSYVSAHQRVHTGEKPYECNVCGKPFAHNSTLRVHQRIHTGEKSYECNDCGKMFSQKS
HLSAHQRIHTGEKPYECNECGKAFAQNSTLRVHQRIHTGEKPYECDECGKTFVRKAALRV
HHTRMHTREKTLACNGFGKS
Download sequence
Identical sequences H2PRN8
ENSPPYP00000021348 ENSPPYP00000021348 9600.ENSPPYP00000021348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]